PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_D6C49C3BC.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 337aa    MW: 36782.6 Da    PI: 6.5078
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_D6C49C3BC.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.5e-5361341128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtd+elv +yLk++v++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkat
  Traes_1AL_D6C49C3BC.2   6 LPPGFRFHPTDDELVGYYLKRRVDNLKIEL-EVIPVIDLYKCEPWELPeKsFLPKRDLEWFFFVPRDRKYPNGSRTNRATTTGYWKAT 92 
                            79****************************.99**************95334445667****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v + +g++ g++ktLvfykgrap ge+tdWvmheyrl
  Traes_1AL_D6C49C3BC.2  93 GKDRKVSCDGGAVCGVRKTLVFYKGRAPGGERTDWVMHEYRL 134
                            ****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-603156IPR003441NAC domain
PROSITE profilePS5100557.0646157IPR003441NAC domain
PfamPF023652.4E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRRVDN LKIELEVIPV IDLYKCEPWE LPEKSFLPKR  60
DLEWFFFVPR DRKYPNGSRT NRATTTGYWK ATGKDRKVSC DGGAVCGVRK TLVFYKGRAP  120
GGERTDWVMH EYRLCQDLLH GASNFIGAYA LCRVIKRTEA GLLHGDAAAK ARPGHRQMSK  180
VGSSSSLVTT DQQLGSLTPS PPRLDIVGNA FQLHSSPSPL YGGGGEVVSG MGTPLGFPQQ  240
DAAATFFIDG DFAGAGETTQ SHMPFFGDMG VVSDHELRWD TLPPCANSTF STTAAAGAAE  300
LWNPAAPNAA APMLCREASD DLAAFFSSLD ENNMVVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-51116112169NO APICAL MERISTEM PROTEIN
1ut4_B4e-51116112169NO APICAL MERISTEM PROTEIN
1ut7_A4e-51116112169NO APICAL MERISTEM PROTEIN
1ut7_B4e-51116112169NO APICAL MERISTEM PROTEIN
4dul_A4e-51116112169NAC domain-containing protein 19
4dul_B4e-51116112169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689850.0AK368985.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2083F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235019.21e-151PREDICTED: NAC domain-containing protein 72-like
SwissprotA4VCM03e-71NAC45_ARATH; NAC domain-containing protein 45
TrEMBLW4ZT800.0W4ZT80_WHEAT; Uncharacterized protein
STRINGMLOC_58950.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.17e-82NAC domain containing protein 71
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]